PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0208s0190.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 404aa    MW: 43734.7 Da    PI: 7.5009
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0208s0190.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.33.7e-25154198145
                     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                             d+epgrCrRtDGKkWRCsr+v +g+++CErHlhrgr+rsrk++e+
  SapurV1A.0208s0190.1.p 154 DPEPGRCRRTDGKKWRCSRDVFAGHNYCERHLHRGRNRSRKPVEN 198
                             79****************************************997 PP

2QLQ47.46e-1780115237
                     QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                             +F+ +Q+q+L+ Q+l+y+ ++a++ +PpeLlq+i+k
  SapurV1A.0208s0190.1.p  80 YFSLEQWQELELQALIYRFMLAGVAIPPELLQPIKK 115
                             6*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.1E-1079115IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.84980115IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.1E-1280113IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.34154198IPR014977WRC domain
PfamPF088793.5E-21155197IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MDFHLKQRRN QHEESGQQPS AKTQKLLMDP HQAPQHPRSS GPAAFPLFLQ EPGSKISSLS  60
AFLDSSTAAN IRLPDIAGNY FSLEQWQELE LQALIYRFML AGVAIPPELL QPIKKSLLHP  120
HSPPCFLHHS LQQQCSYYQP SLLQTGYWGR ADMDPEPGRC RRTDGKKWRC SRDVFAGHNY  180
CERHLHRGRN RSRKPVENPT PTISTNVTCT GIGGAGGTAS AAAFNHSAAP TISEVVNGTH  240
FSHTLESPSI HFNHSSKTES KGLIGSLPPN EEAGNRYDGH ILWHFFDDWP RSVDESGNVN  300
GGSSMNSLTC LSVSMPGNSP ASDVSLKLST GNNIAEPEPE PVPAPTPRGN TSKWAAAGWG  360
TNITNQAVAS MGGPLAEALS SSTTNSSPTS VLHQLSRPTV SET*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011018895.10.0PREDICTED: growth-regulating factor 3 isoform X1
TrEMBLB9MTP80.0B9MTP8_POPTR; Uncharacterized protein
STRINGPOPTR_0006s11630.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF78953242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.16e-68growth-regulating factor 4